PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G36610.1
Common NameLOC102714908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 341aa    MW: 36841.1 Da    PI: 6.5828
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G36610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.5e-102532852355
                   SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
      Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                   +yps+ e++ LA+++gL+++q+++WF N+R ++
  OB03G36610.1 253 PYPSEMEKAALAESTGLDKKQITNWFINQRKRH 285
                   8*****************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.3E-1964108IPR005540KNOX1
PfamPF037902.9E-1866104IPR005540KNOX1
SMARTSM012561.1E-25117168IPR005541KNOX2
PfamPF037917.3E-21121166IPR005541KNOX2
SMARTSM003891.4E-10224292IPR001356Homeobox domain
PROSITE profilePS5007111.548225288IPR001356Homeobox domain
SuperFamilySSF466894.15E-17227292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-24232289IPR009057Homeodomain-like
CDDcd000865.47E-12239288No hitNo description
PfamPF059201.8E-16245284IPR008422Homeobox KN domain
PROSITE patternPS000270263286IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MEQLHLLLAN GGAKDTSTAP FCSARDFTYA ASPPPALRPA SGRQSNHGGG GGGGQSSSPL  60
PSEAILKAKI MSHPLYPSLL RAFVDCRKVG APLDVAGRLS SLTDDLQSNS GDWRRPAELQ  120
PAADHELDQF METYCYMLTR YGQELGRPIQ EAEEFFRGIE AQIESLALDD VSCEGDASSE  180
DENAALPENG GGGGGAAFGD TEVTTSHLLN KYSGYMSSLL SEISRKKKNS TGHLPGKARQ  240
KLLHWWHLHY RWPYPSEMEK AALAESTGLD KKQITNWFIN QRKRHWKPTP AAAAAMDVFL  300
HPPYGASSSS SAALRPVEGG GGSWQRCFEF DGGCAYPRGG P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352054e-70BT035205.1 Zea mays full-length cDNA clone ZM_BFb0044N12 mRNA, complete cds.
GenBankBT0406224e-70BT040622.1 Zea mays full-length cDNA clone ZM_BFc0104L02 mRNA, complete cds.
GenBankKJ7275714e-70KJ727571.1 Zea mays clone pUT5431 HB transcription factor (HB110) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651679.10.0PREDICTED: putative homeobox protein knotted-1-like 5
SwissprotQ75LX91e-128KNOS5_ORYSJ; Putative homeobox protein knotted-1-like 5
TrEMBLJ3LRI50.0J3LRI5_ORYBR; Uncharacterized protein
STRINGOB03G36610.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.17e-67KNOTTED-like from Arabidopsis thaliana